PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo1G0043100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 287aa    MW: 30363.8 Da    PI: 7.4323
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo1G0043100genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.86.9e-10953345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     +WT e ++ + +a ++++ +   +W++Ia+ +  g++ +++k+++ 
   Spipo1G0043100  9 SWTREQEKAFENALALHPEDspdRWERIAEAVS-GKSVEDIKLHYE 53
                     7********************************.**********96 PP

2Myb_DNA-binding39.99.8e-13118162347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
   Spipo1G0043100 118 AWTEEEHRLFLLGLDKYGKGDWRSISRNFVISRTPTQVASHAQKY 162
                      6*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129311.642560IPR017884SANT domain
SMARTSM007172.2E-9658IPR001005SANT/Myb domain
SuperFamilySSF466892.48E-11863IPR009057Homeodomain-like
PfamPF002497.3E-8952IPR001005SANT/Myb domain
CDDcd001672.32E-8956No hitNo description
PROSITE profilePS5129417.576110167IPR017930Myb domain
SuperFamilySSF466898.28E-17113168IPR009057Homeodomain-like
SMARTSM007171.6E-10115165IPR001005SANT/Myb domain
TIGRFAMsTIGR015574.7E-17115165IPR006447Myb domain, plants
PfamPF002493.4E-11118162IPR001005SANT/Myb domain
CDDcd001675.01E-10118163No hitNo description
Gene3DG3DSA:1.10.10.605.4E-11118161IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MEEPSSSSSW TREQEKAFEN ALALHPEDSP DRWERIAEAV SGKSVEDIKL HYELLIEDIN  60
GIESGLVPLP CYVSSSDSPA EHAGEGGAGS KKGSHSHGDL GHGGKGSRAD QERRKGIAWT  120
EEEHRLFLLG LDKYGKGDWR SISRNFVISR TPTQVASHAQ KYFIRLNSMN KDRRRSSIHD  180
ITTVNNGESS PQGPITGQTN GPSVSAAKSG KASPQPPAGP NGVAIYGPTT IGQPVGGPLV  240
SAVGTPVSLP TPAPMAYGVR APPPGAIVQG APVNMTYPMP HTSAHR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-1910751176RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010935571.11e-143PREDICTED: transcription factor DIVARICATA
RefseqXP_010935570.11e-143PREDICTED: transcription factor DIVARICATA
RefseqXP_010935568.11e-143PREDICTED: transcription factor DIVARICATA
RefseqXP_010935567.11e-143PREDICTED: transcription factor DIVARICATA
RefseqXP_010935566.11e-143PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H76e-68DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A068VFI41e-140A0A068VFI4_COFCA; Uncharacterized protein
STRINGGLYMA07G28310.11e-139(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63763854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-99MYB family protein